Services on Demand
Article
Indicators
Related links
Bookmark
Salud Pública de México
Print version ISSN 0036-3634
Salud pública Méx vol.46 n.6 Cuernavaca Nov./Dec. 2004
http://dx.doi.org/10.1590/S0036-36342004000600010
ARTÍCULO DE REVISÍON
Helicobacter pylori: focus on CagA and VacA major virulence factors
Helicobacter pylori: enfoque sobre los factores de virulencia CagA y VacA
Gonzalo Castillo-Rojas, PhDI; Marisa Mazarí-Hiriart, D EnvII; Yolanda López-Vidal, PhD.I
IPrograma de Inmunología Molecular Microbiana, Facultad de Medicina, Universidad Nacional Autónoma de México (UNAM). México, DF, México
IIInstituto de Ecología, UNAM. México, DF, México
ABSTRACT
After colonizing the human gastric mucosa, Helicobacter pylori can remain within the host for years and even decades, and is associated with several, highly significant gastric pathologies. In Mexico, the seroprevalence at 1 year of age is 20% and the estimated increment in seropositivity per year is 5% for children aged 1-10 years. More than 80% of adults are infected by the time they are 18-20 years old. Bacterial virulence factors have been proposed for H. pylori, such as urease, flagella, heat-shock protein, lipopolysaccharide, adhesions, vacuolating cytotoxin, cag pathogenicity island and the cytotoxin-associated protein, the latter being the most studied mechanism to date. The English version of this paper is available at: http://www.insp.mx/salud/46/eng
Key words: Helicobacter pylori; virulence factors; pathogenesis
RESUMEN
Después de colonizar la mucosa gástrica humana, Helicobacter pylori puede permanecer por años e incluso décadas en el humano, y se asocia a varias patologías gástricas. En México, la seroprevalencia estimada es de 20% en niños de un año de edad, con una tasa de incremento en seropositividad de 5% anual durante los primeros 10 años de vida hasta alcanzar 80% en adultos jóvenes entre los 18 y 20 años de edad. Los factores bacterianos de virulencia propuestos para H. pylori son ureasa, flagelos, proteínas de choque térmico, lipopolisacárido, adhesinas, citotoxina vacuolizante, isla de patogenicidad y la proteína asociada a la citoxina; este último factor es el más estudiado hasta la fecha. El texto completo en inglés de este artículo está disponible en: http://www.insp.mx/salud/46/eng
Palabras clave: Helicobacter pylori; factores de virulencia; patogénesis
Helicobacter pylori (H. pylori), formerly known as Campylobacter pyloridis and then as Campylobacter pylori, was isolated for the first time by Barry Marshall and Robin Warren in 1982. This led to a new era in clinical microbiology, when bacteria were found to be a cause of peptic ulcers. H. pylori is at present recognized as an important pathogen.1 H. pylori causes persistent infection in a high percentage of the population; particularly in countries with a high proportion of lower socioeconomic groups.2 Once acquired, H. pylori infection persists in the majority of individuals for years, decades and in some cases for life. Infection causes gastric inflammation of the mucosa (superficial chronic gastritis) and polymorphonuclear infiltration (active chronic gastritis). However, the effect of infection varies from individual to individual with the majority becoming asymptomatic carriers, while others develop peptic ulcers. In some cases, individuals can develop chronic atrophic gastritis, a risk factor for the development of adenocarcinoma and gastric lymphoma.3 The clinical outcome of H. pylori infection is determined by a complex interaction of environmental influences, and by factors related to the microbial virulence and host. H. pylori bacteria that carry the cagA and vacA genes have enhanced pathogenicity, and the coexistence of cagA and vacA with other bacterial virulence factors further worsens clinical outcomes.
Microbiological characteristics of H. pylori
H. pylori is a curved spiraled or S-shaped gram-negative organism, approximately 0.3 to 1.0 µm wide, 1.5 to 5.0 µm long, and microaerophilic (O2 5%, CO2 10% and N2 85%). Its optimal temperature for growth is between 35 °C and 37 °C,4 although some strains are still able to grow at 42 °C. Growth can also take place in 0.5% glycerol and in 0.04% triphenyltetrazolium chloride, and it is known that high humidity can be favorable. Incubation usually lasts between 3 and 5 days, although incubation of up to 7 days has occasionally been observed. Biochemically, H. pylori is catalase and oxidase positive and contains the potent enzyme urease, used in identifying the presence of H. pylori. The colonial morphology of H. pylori is described as small, gray, and slightly hemolytic colonies.5
Epidemiology
Epidemiological studies have shown that infection with H. pylori is a worldwide phenomenon.6 However, infection rates between developed and developing countries differ significantly. For example, in the United States the annual incidence of infection is between 0.5% and 1% in children under 10 years of age, with infection rates increasing to 50% in adults around the age of 60 years.7 Interestingly, certain ethnic groups, such as Afro-Americans, Hispanics, and Native Americans, are infected at an early age. Intra-familiar transmission, which is associated with low socioeconomic status, deficient healthcare practices and overcrowding, is high in these groups.7 In developing countries, it seems that most of the population (80%) becomes infected at an average age of 10 years, which is probably also related to the aforementioned factors of high intra-familiar transmission.8
In 1997, Torres et al performed a seroepidemiological study using a bank of representative sera from populations throughout Mexico (11 605 sera), which included sera from individuals between 1 and 90 years of age.8 Their results showed that 20% of one-year-old children had antibodies against H. pylori, with an increased seropositivity of up to 50% in children who were 10 years of age.8
Currently, there is no information that indicates the existence of a non-human reservoir, which suggests that infection is specific to humans. However, there are studies concerning the experimental infection of primates with H. pylori9 that involve the development of gastritis and clinical ulceration very similar to those seen in humans. The specific transmission mechanisms of H. pylori remain unknown, but it is generally considered that infection is spread from individual to individual through an oral-oral and oral-fecal pathway. These methods of transmission are considered important in the wide distribution of H. pylori6 infection although other methods are suspected.10-12
The understanding of H. pylori microbial ecology and vehicles of transmission remains unresolved.13 Nevertheless, some epidemiological data suggests water as a possible vector. A few studies around the world have been carried out in aquatic environments focusing on a possible waterborne pathway for H. pylori infection. A correlation between water sources and H. pylori prevalence was described in Peru, highlighting municipal water sources an as important vector for H. pylori in addition to socioeconomic factors.12,14,15 In Colombia, in addition to water itself, raw vegetables, especially lettuce, that are grown in fields irrigated with wastewater, are considered a potential source for infection.16
A population in Chile showed evidence of potential H. pylori infection from vegetables, consumed raw.17 In a study in Sweden, the bacterium was detected in well water, municipal water, and treated wastewater. The presence of the bacteria in Swedish waters was remarkably high and not expected since the treatment plants were modern with effective treatment.18 In the US, although H. pylori was found in surface water and shallow groundwater, no correlation was found between H. pylori and traditional indicator organisms.13 In Mexico City, the H. pylori 16S rRNA gene was detected in five water systems.11 In three of the water systems, microbiological samples yielded Aeromonas hydrophila, Aeromonas caviae, Aeromonas veronii and Vibrio fluvialis, and showed residual chlorine less than the inactivation dose, suggesting that conditions were suitable for the potential survival of H. pylori, and other enteric pathogens in these environments.12 A representative study carried out in the Mexico City Metropolitan Area showed the presence of H. pylori with CagA.19 The viability of H. pylori in both water and vegetables needs to be confirmed, as does a relationship between human and environmental strains.
H. pylori is the etiologic agent in 70% - 80% of active chronic gastritis cases, the most common form of chronic gastric inflammation.20 The disease affects the antrum and fundus, of the stomach, with histology frequently showing infiltration of lymphocytes, plasma cells and some eosinophils. It appears that the inflammatory process is more significant in the antrum than in other areas of the body.21 H. pylori colonizes the gastric mucosa and can remain there for years or even decades with minimal symptoms in most cases. However, some cases have been reported describing significant morphological changes in the gastric mucosa, ranging from mild inflammation to ulceration. Others progress from chronic gastritis to cancer, through chronic atrophic gastritis, intestinal metaplasia, dysplasia and carcinoma.22
The high prevalence of infection H. pylori may be the cause of around 40% of all gastric cancer cases worldwide (47% in developing countries).23 In some countries such as Mexico, there are zones of substantial risk. For example, in the highlands of Chiapas, there is a high incidence of H. pylori-associated gastric cancer among native Mexicans.24 Based on seroepidemiological case-control studies, H. pylori was classified as a class I carcinogen by the International Agency for Research on Cancer in 1994. A prospective long-term study of 1 526 cases of distal gastric cancer and 280 controls revealed that, compared with H. pylori-negative individuals, those infected with H. pylori are 2.9-34.5 times more likely to develop distal gastric adenocarcinoma.25 This depends on the grade of mucosal atrophy or the presence of intestinal metaplasia.25 While this study shows the important role of H. pylori in the pathogenesis of gastric disease, it is still unclear which factors determine the subset of infected individuals developing life-threatening disease compared with those remaining as H. pylori carriers.
Virulence factors
Urease is an essential virulence factor, since it allows H. pylori to survive in the highly acidic and hostile environment of the lumen of the stomach before it reaches the mucus layer. Urease is a protein that is expressed in great quantities by H. pylori, representing 6% of its dry weight.26 It is also the catalyst for urea hydrolysis, which in turn produces ammonium and carbon dioxide as by-products. The enzyme is made up of six subunits of UreA and six of UreB, organized in a double ring of 13 nm in diameter and a molecular size of 550 kDa.27 The biosynthesis of urease is controlled by a group of seven contiguous genes (ureABIEFGH), including the genes that code for urease (ureAB), and five accessory genes that are responsible for the reception and insertion of nickel ions (Ni2+) on the active site of the apoenzyme.28
Negative urease mutant strains, built by inserting resistant antibiotic cassettes in the ureA, ureB and ureG genes,29 lost urease activity. However, alterations in the rate of growth were not studied, demonstrating that urease activity is not necessary for the viability of the microorganism in vitro. However, Tsuda et al.30 demonstrated that a negative urease strain, created via the ureB gene, lacked the ability to colonize the nude mouse stomach. Also, the co-inoculation of a negative urease strain (ureG-) with a positive urease strain showed colonization by the positive urease strain in the stomach of gnotobiotic piglets,31 suggesting that neutralization of the microenvironment is not the only function of urease.
Urease can contribute to cell toxicity by producing ammonium as a by-product, which characterizes urease as a chemotactic factor, activating polymorphonuclear leukocytes and monocytes for cytokine release. This process produces a localized inflammatory response leading to damage of the gastric epithelial tissue.21,32 In the presence of ammonium chloride, vacuolating cytotoxin is highly active. The ammonium-induced cytotoxin generates more vacuoles compared with the toxin alone. This suggests that a substantial cooperation between urease and vacuolating cytotoxin causes cellular damage.33
Motility is also an essential factor in H. pylori colonization, based on the fact that aflagellate non-motile variants of H. pylori are able to infect gnotobiotic piglets.34 H. pylori usually possesses two to six polar, sheathed flagella that are continuous with the outer membrane, with a similar composition in lipopolysaccharides, phospholipids and proteins.35 However, the function of the flagellar sheath remains uncertain. Flagella are composed of two different flagellin subunits, encoded by the flaA and flaB genes.36 Both flagellin subunits share a 50% identity in terms of amino acids and probably evolved from a common ancestor. The induced mutation of flaA and flaB genes showed that both genes are essential for motility36 and for the colonization of gnotobiotic piglets.37
Binding of H. pylori to gastric epithelial cells is an important virulence factor for the colonization of the human stomach. The microorganism adheres to the epithelial cells by means of adhesins and receptions.38 Adhesins are bacterial proteins, glycoconjugates, or bacterial lipids involved in the initial stages of colonization by mediating an interaction between the bacterium and the receptors on the surface of epithelial cells, such as lipids, proteins, glycolipids or glycoproteins. Adherence of bacteria to host cell receptors triggers cellular changes that include signal transduction cascades, leading to infiltration of inflammatory cells (neutrophils and monocytes) and possibly to the persistence of the microorganism.38 Once H. pylori reaches the epithelial layer, it adheres to the cells using BabA, SabA, AlpA, AlpB, HopZ, HpA, and other adhesins. The H. pylori BabA adhesin facilitates the binding of H. pylori to the fucosylated Lewis b histo-blood group antigen which is present on the surface of gastric epithelial cells. In animal models, Lewis b-dependent attachment of H. pylori to gastric epithelial cells is accompanied by increased severity of inflammation, development of parietal cell auto-antibodies, and parietal cell loss.39 BabA has been investigated in the most detail. H. pylori strain CCUG 17 875 was used for the initial characterization of BabA and contains two copies of the babA gene (designated babA1 and babA2). In this strain, the babA2 gene encodes a functional BabA outer membrane protein that binds to Lewis b; a 10-nucleotide segment containing the expected codon that initiates translation is deleted from the babA1 gene, and therefore this gene is not predicted to be translated. In contrast to H. pylori CCUG 17 875, each of two H. pylori strains for which entire genome sequences are available (strains 26 695 and J99) contain only one copy of babA (designated HP1 243 and jhp0833, respectively). Studies have been reported that detect a babA2 genotype in 82 (71.9%) of 114 H. pylori isolates using PCR designed to amplify babA2 but not babA1 genes. Reverse transcription-PCR analyses have indicated that the babA2 gene has been transcribed in each of the strains that contained a babA2 gene. Moreover, 28 of 31 babA2-positive H. pylori strains were reported to bind to Lewis b compared to none of the 23 babA2-negative strains included in the study40 Heterogeneity among H. pylori strains in expressing the BabA protein may be a factor in the variation of clinical outcomes among H. pylori-infected humans.40
Recently, H. pylori has been shown to express a second adhesin, SabA, that binds to sialylated and fucosylated glycoconjugates such as sialyl-dimeric-Lewis x. Such sialylated derivatives increase in the gastric epithelium as a consequence of inflammation, indicating that H. pylori-induced inflammation promotes colonization through the higher regulation of appropriate adhesion targets in host tissue. The sabA gene is subject to an on-off switch; hence, the gastric population of H. pylori is likely to contain bacteria that are either capable or uncapable of binding to inflamed tissue, a property that could contribute to bacterial persistence and shedding.41
Receptins42 are microbial proteins with binding properties for mammalian proteins. However, this excludes the first step of adherence to the mammalian cell surface which is required for a microorganism to establish itself within a host. Instead, receptins relate to the later stages of adherence that allow the persistence of a long-lasting infectious process through the binding to a soluble serum protein (immunoglobulins and albumin) or via proteins of the extracellular matrix (heparin, heparin sulfate, fibronectin, fibrinogen, collagen, laminin, plasminogen, plasmin and vitronectin), of which many are also present in host serum. In a normal, healthy human, the soluble serum protein and extra cellular matrix proteins are not exposed and thus, are not accessible for interaction with bacteria; however, these molecules could become exposed after tissue trauma following a mechanical or chemical injury, or after an infection.38 These events allow H. pylori to evade the host's immune defenses and to initiate the establishment of a persistent infection.38
Another virulence factor is the lipopolysaccharide (LPS) of H. pylori that expresses the Lewis "x" (Lex) and/or Lewis "y" (Ley) carbohydrates in its "O" antigen.43 A recent study demonstrated that the LPS structure of the NCTC 11 637 strain of H. pylori is similar to the Lewis "x" antigen found in blood for type O and on gastric epithelial cells.44 The MO19 strain of H. pylori has a Lewis "y" type LPS, whereas the P466 strain expresses both LeX and LeY.45 The expression level of these Le antigens varies among strains, showing phase variation stimulated by the Lewis antigen expressed on the surface of epithelial cells.46 Occasionally, H. pylori expresses other Lewis antigens47 with a different number of fucose residues, Lea, Leb. The Lewis antigens of H. pylori show a dual participation in pathogenesis: (i) the induction of a molecular mimicry, possibly helping the microorganism to avoid the initiated immune response following stomach colonization and thus, favoring permanence of H. pylori for a long period within the gastric niche.48 However, Takata et al49 showed that LeX and LeY expression is not necessary for mouse gastric colonization or for H. pylori adherence to epithelial cells; (ii) the induction of an auto-immune response against Lewis antigens expressed by H. pylori, shared by the eukaryote and thus leading to direct or indirect damage.50
Another important virulence factor in H. pylori is the cytotoxin-associated protein (CagA), which was identified as an immune dominant antigen, located on the surface of the bacterium. It varies in size from 120 to 130 kDa, and is present in approximately 60% of H. pylori strains.51 Notably, the CagA protein is frequently co-expressed with vacuolating cytotoxin (VacA), which is the reason for designating it as a cytotoxin associated protein. However, these genes are separated by 300 kb and the expression of VacA is independent of the presence of the cagA gene; since null mutants in cagA, do not affect the vacuolating cytotoxin activity of H. pylori.52,53 Also, the expression of the CagA protein for H. pylori strains is highly associated with peptic ulceration.51
The cagA gene encodes for a protein containing 1 147 amino acids with a theoretical mass of 128 012 Da. This protein is highly hydrophilic, shows an EFKNGKNDFSK and EPIYA sequence repetition, and an extension of six contiguous asparagines. In the 3 406 bp position of the gene sequence, a fragment of 102 bp is present, that is made up of three segments, which are present once in the 84-183 (ATCC 53 726) strain and three times in the G39 strain. The repetition of the 102 bp segment is what confers size variability on the CagA protein, without producing antigenic diversity. However, these repetitions are rich in proline and very hydrophilic; they also have a high probability of surface exposure and are highly immunogenic.54
In 1998, Evans et al55 analyzed the variable region of the cagA gene, and found that there are two adjacent and variable regions, denoted as proximal and distal. The proximal-variable region of CagA extends from a motif of 4 to 6 asparagine residues to a 7 amino acid repeat sequence (KIDQLNQ); the distal-variable region is confined between KIDQLNQ and a well-conserved duplicate, KIDQLNQ. The variation in the size of CagA from one strain to another is a property of the distal variable region; however, it appears that the greatest diversity, in terms of nucleotide and amino acid sequence variations, occurs within the proximal variable region. This means that from 1 to 7 consensus amino acid residues may be present or absent immediately following the asparagine motif, because there are two different versions of the repeat sequence (EPIYA or PEEPIYA).
Additionally, in 1998, Yamaoka et al analyzed the number of repeat sequences in the variable region at end 3' of the cagA gene, describing four types of primary structure, where the type C primary structure was associated with higher levels of anti-CagA antibody and more severe degrees of gastric atrophy.56 In a later study, they found that H. pylori strains with more than three repeat regions at the 3' region of the cagA gene were associated with enhanced histological injury and with reduced survival in acidic conditions.57 Recently, Azuma et al.58 analyzed the frequencies of the genotypes that contained more than four repetitions of the 5-amino acid sequence EPIYA at the 3' region of the cagA gene and found that H. pylori infection with the cagA genotype with more than four EPIYA sequences may correlate with the pathogenesis of atrophic gastritis and gastric cancer.
Censini et al59 analyzed the DNA regions flanking the cagA gene, which led to the discovery of a region of 40 kb, to which they designated the Cag Pathogenicity Island (cag-PAI). The Cag-PAI is a 40-kb locus that is inserted into the chromosomal glutamate racemase gene (glr). It contains 31 genes and flanks direct repetitions involved in the integration of the 40-kb locus in the genome. The presence of the 605 insertion sequence (IS605) and the low G + C content (35%), which is smaller than the rest of the H. pylori genome (39%), suggests that the cag-PAI was acquired from another microorganism by horizontal transfer. Additionally, the order of the genes in the cag-PAI is essentially conserved among the H. pylori strains.59, 60
Different studies revealed that the Cag-PAI can be present as a simple continuous unit or divided into two regions (cagI and cagII) for an IS605 element or for a segment of chromosomal DNA, and can also show a partial loss of the Pathogenicity Island.59 This structural variation of the cag-PAI explains the existence of cag-PAI negative and cag-PAI positive strains. On the other hand, six of the genes in the cag-PAI are homologous to well-known genes present in a collinear arrangement in operons of Bordetella pertussis, Agrobacter tumefaciens, Escherichia coli, Legionella pneumophilla, Rickettsia prowazekii and Brucella suis. These operons encode for type IV secretion systems, specialized in the transfer of a variety of multimolecular complexes across the bacterial membrane to the extra cellular space or into other cells.61
A number of events occur in epithelial cells after contact with a bacterium that possesses the cag-PAI. Attachment of cag-positive H. pylori to human gastric cells results in the secretion of interleukin-8, an inflammatory mediator, by activating nuclear factor kappa beta complexes (NF-kB). It also induces the effacement of microvilli at the site of attachment and cytoskeleton rearrangement followed by the formation of a cup/pedestal directly beneath the bacterium,62 due to the tyrosine phosphorylation of the CagA protein.63 In addition, it activates transcription factor AP-1 and the ERK/MAP kinase cascade leading to expression of the proto-oncogenes c-fos and c-Jun. These result in ELK-1 phosphorylation and increased c-fos transcription.64 H. pylori mutated in the cag gene does not induce any of the above activities.
Two possible signaling mechanisms may occur in the epithelial cells after contact with H. pylori. The first involves an unknown factor, which is translocated into the cell by the type IV secretion system of cag-PAI that activates the transcription factor NF-kB to induce interleukin-8 expression. It is likely that this mechanism is involved in the activation of mitogen-activated protein (MAP) kinases and the activator protein (AP)-1 transcription factor. It is not yet certain whether this pathway needs a yet unknown effect, or whether it is simply activated by the type IV secretion system itself, which perturbs the cell membrane.65 The second mechanism involves the CagA protein; this protein is translocated into the eukaryotic cells for the IV secretion system. Once inside the cells, the protein triggers signal transduction and acts as a growth factor, altering the integrity of the epithelium by interacting directly with host ZO-1 protein.66 This is part of the apical junction complex, and the interaction disrupts the epithelium integrity. Inside the host cell, CagA may be phosphorylated in its tyrosine residues on the sequence EPIYA, located in the C-terminal region of the CagA protein67 by the host-cell kinase c-Src.68 After this process, the phosphorylated-CagA (CagA-P) is likely to bind to SHP-2 phosphatase and stimulate the phosphatase activity of SHP-2. This complex can activate multiple pathways: a) it may bind directly to the Neural Wiskott-Aldrich syndrome protein (N-WASP), inducing it to bind the Arp2/3 actin nucleator, thus stimulating actin polymerization with the consequent pedestal formation; b) the CagA-P-SHP-2 protein complex may activate the Rho family of the small, GTP-binding protein (Cdc42, Rac or Chp), which controls the organization of the actin cytoskeleton. This pathway could also cause actin polymerization and pedestal formation by activating N-WASP; or c) the CagA-P-SHP-2 protein complex may trigger a signaling cascade, possibly via the MAP pathway, which may induce transcription of nuclear genes. However, there is not enough evidence yet to support involvement of this pathway.65
Although the cagA gene is considered as a virulence marker, previous reports suggest the existence of allelic variations in H. pylori strains isolated from different ethnic populations.69 These data have been confirmed by Arie Van der Ende et al70 by comparing a 243 bp fragment of the cagA gene, isolated from Dutch and Chinese patients. However, the variable region at the 3' end of the cagA gene is the region where there is more heterogeneity due to the number of 102 bp fragment repetitions, and where substantial nucleotide differences have been observed among the isolated occidental and East Asian strains.57,58,71 The occidental strains present a specific sequence denoted as the "Western cagA-Specific Sequence" (FPLKRHDKVDDLSKVGRSVSPEPIYATIDDLGG P) whilst the specific sequence present in Asian strains has been termed the "East Asia cagA-Specific Sequence" (ESSAINRKIDRINKIASA GKGVGGFSGAGRSASPEPIYATIDFDEANQAG). Backert et al67 demonstrated that the tyrosine phosphorylation sites in the EPIYA-containing repeat sequence of CagA from WSS and ESS sequences are essential for pedestal formation. Recently, Higashi et al71 showed that the repeat sequence contains a tyrosine phosphorylation site, and that CagA proteins having more than one repeat sequence underwent greater tyrosine phosphorylation, exhibiting increased SHP-2 binding and inducing greater morphological changes. They also observed that the East Asia CagA-specific sequence conferred stronger SHP-2 binding and morphologically transforming activities than those related to the Western CagA-specific sequence. Such structural differences in the CagA protein could be implicated in the increased risk for developing gastric cancer in people infected with H. pylori strains that express the CagA protein with a high binding affinity to SHP-2.
Clearly, the ability to produce a vacuolating cytotoxin (VacA) is an important virulence factor of H. pylori. VacA is responsible for the in vivo formation of vacuoles in gastric epithelial cells,72 as well as different in vitro cell lines.73 It is possible that oral administration of cytotoxin to suckling mice produces a deterioration of the gastric mucosa.74
Vacuolating cytotoxin is coded for by the vacA gene located in a single copy within the H. pylori chromosome.32,75 The vacA gene has approximately 3 864 bp and presents 5 open reading frames, only one of which is suitable for coding the vacuolating cytotoxin. Since 1994, the first complete sequence studies of the vacA gene75,76 have been performed in H. pylori 60 190 tox+ and 87-203 tox- strains. Analysis of a fragment of the 1 541 bp of the vacA gene showed a 64.8% homology between the nucleotide sequence of the tox+ strain and tox- strain.77 In addition, a region of approximately 567 bp was located upstream from the vacA gene, which corresponds to the tRNA gene of cystein-synthetase,75 and is homologous to that found in E. coli. In 1995, the 0.73 kb region was analyzed in 10 strains of H. pylori, the position corresponding to the mid region of the vacA gene.76 This mid region showed a nucleotide identity of 70.4% between tox+ and tox- strains, and an amino acid identity of 58.7%. Based on their sequence, strains were classified into two allele families: m1-type allele (for H. pylori strains with cytotoxic activity) and m2-type allele (for H. pylori strains with no cytotoxic activity). In addition, the sequence of a 0.5-kb fragment was analyzed, which corresponded to a sequence-signal region of the vacA gene with important differences between tox+ and tox- strains. Based on these results, strains were classified into three further allele families: s1a-type, s1b-type, and s2-type alleles.
Atherton et al76 performed the characterization of the vacA gene from59 H. pylori strains isolated from patients with different pathologies (peptic ulcer, gastritis and asymptomatic patients). By using specific initiators and PCR, they amplified the signal sequence region (s1a, s1b, s2), and the mid region (m1 and m2) of each strain. They reported that there were patients who presented strains with s1a/m1, s1b/m2, s1b/m1, s1b/m2, and s2/m2 genotypes, but there were no patients who presented the s2/m1 genotype. Upon studying the cytotoxic activity in single layers of HeLa cells from supernatants of each strain isolated from their study population, they observed that the strains presented different cytotoxic activity, classifying them as: high, mid and null vacuolating activity.73,76 In this study, a meaningful association between the vacA genotype and vacuolating activity was also observed, showing that strains with the s1a/m1 genotype presented the greatest cytotoxic activity. They also reported that strains with s1b/m1, s1a/m2, and s1b/m2 genotypes presented an activity from mid to low, whilst strains with the s2/m2 genotype presented no cytotoxic activity. In addition, they reported that s1a/m1 strains were isolated with greater frequency from patients with peptic ulcers, s1b/m1 strains were mainly found in samples from patients with gastritis, and s2/m2 strains were isolated in greater numbers from asymptomatic patients.76
Although this vacA genotyping system has been successfully used to study bacteria isolated from patients in the United States and some European countries, the m1/m2 dichotomy does not seem to be sufficient for classifying strains from Asian countries, and probably, from other regions of the world.78 A study in Germany of 30 H. pylori strains isolated from patients with active chronic gastritis, peptic ulcers and gastric cancer, reported that only one strain could not be characterized by specific initiators in the mid region of the vacA gene.76 Upon analyzing the mid region nucleotides of these strains, the study reported a nucleotide difference of 9.3% when compared with the mid region sequence of an m2-type strain (Tx30a). This new mid region was labeled as m3-type.79 As in Germany, studies in Belgium78 showed a new mid region for the vacA gene, designated as m1a, and another m1-m2 type mid region in strains isolated from Chinese patients. In addition, there are reports from China, Hong Kong, Japan, Thailand, France, Germany, Hungary, Italy, the Netherlands, Poland, Portugal, Rumania, Spain, Switzerland, United Kingdom, Brazil, Canada, Colombia, Costa Rica, Peru, United States, Australia and Egypt78,79 where the characterization of the signal sequence region and/or vacA gene mid region could not be achieved using the proposed scheme. DNA sequencing and new specific primer designing was necessary for the characterization of "untypeable" strains. Nowadays, the vacA s1 region has been subtyped into s1a, s1b, and s1c; the m1 region was subtyped into m1a, m1b, and m1c; and the m2 region has been subtyped into m2a and m2b. Previous studies showed that the VacA s1a or s1b genotypes were predominant in strains from Western countries, whereas s1c is highly prevalent in strains from East Asia. The vacA m1a and m2a genotypes were predominant in strains from Western countries, the m1c genotype was predominant in strains from South Asia, and the m1b and m2b genotypes were predominant in strains from East Asia.80 In Mexico, Morales-Espinosa et al showed vacA diversity was higher than that described in other populations, and that co-infection with multiple H. pylori strains with different VacA genotypes is common. In addition, this study found a previously undescribed vacA s2/m1 genotype.81 The variation in the global distribution of the VacA genotypes may show a degree of congruence with reports linking vacA genotypes with certain clinical outcomes in different geographic regions.
The VacA cytotoxin is synthesized as a 140 kDa protoxin, which contains three functional domains: a) an N-terminal signal sequence of 33 amino acids (the leading peptide being 3 kDa), b) a mature 87 kDa cytotoxin, and c) a C-terminal domain of 50 kDa associated with an external membrane.82 In order to be excreted, the protoxin breaks both its amino part end (signal peptide) and its carboxyl region end, remaining as a monomer of approximately 95 kDa to form a mature toxin composed of 6 or 7 monomers. Upon binding, a structural rearrangement takes place, the result resembling a 6- or 7-petal flower with a center (ring) of 30nm in diameter.83 Each monomer presents a flexible exposed handle, which undergoes a proteolysis rupture dividing it into two sub-units: one of 37 kDa (P37) and the other of 58 kDa (P58).82 However, it is unknown if the same toxin causes such a break or, if there are external proteases responsible for hydrolysis, which act on the bacterial surface. It is also unknown if the processing of two such sub-units is essential for toxic activity. It has been observed that when the VacA is exposed to an acid pH or to weak bases such as ammonium chloride, there is separation of monomers, together with an increase in the vacuolating activity of single layers of HeLa cells.72,82 Recent studies have shown that the sub-unit P58 carboxy-terminal domain is responsible for acknowledging receptors on the surface of epithelial cells, although interaction between both sub-units (P37 and P58) is necessary for the toxin to be internalized and actuated. In vitro studies82 have proved that VacA is bound to a cell by interacting with specific receptors. This binding depends on both the cytotoxin concentration and the saturation of receptors on the cellular surface. It appears that cytotoxins enter the cytosol kinetically in a similar way that endocytosis is mediated by a receptor. It has been proposed that the receptor for the epidermal development factor (EGF) and a 140-kDa protein act as the receptors for VacA.84,85
Three mechanisms of action for vacuolating cytotoxin have been reported: (1) large vacuoles form in the cytoplasm of epithelial cells72,73 originating at the perinuclear level, until they totally fill the cell cytosol, causing massive cellular vacuolation. Membrane vacuoles, induced by cytotoxin, contain a high level of the small binding GTP protein, Rab 7. This causes membrane vacuoles to be formed by a hybrid of late endosomes and membrane lysosomes.86 The lumen of large vacuoles, induced by VacA in both the cytoplasm of culture cells and in gastric epithelial cells, is acidified by the activity of a proton pump via a vacuolar-type ATP-ase bound to the membrane of these vesicles.87 ATP-ase V is present in various intra-cellular compartments of eukaryotic cells and participates in several processes in endocytic and exocytic pathways. This complex is bound to the membrane and hydrolyzes ATP for the proton pump inside the lumen of membrane limiting compartments. The VacA cytotoxin can change membrane traffic at the endosoma-prelysosome level. These changes affect the protein traffic, the bound traffic and the processing of antigens depending on bound changes, and produce deterioration in the proteolytic degradation within lysosomes, thereby bringing about lethal dysfunction of the cell. (2) A separate mechanism of action involved in VacA vacuole formation is the increase in permeability of in vitro polarized cells. This leads to an increase in the passage of low molecular weight molecules,88 which seems to increase nutrient flow from inside the cell to the sub-mucosa, thereby favoring H. pylori survival. The adherence of VacA to polarized single layer cells causes a decrease in trans-epithelial resistance through the single layer. Evidence shows that the effect of VacA in decreasing trans-epithelial resistance is an increase in intra-cell permeability, since the active cytotoxin continues to be associated with the bacteria.88 (3) The third mechanism involves the formation of channels through the lipidic layer of the cell membrane. Tombola et al88 showed that the cytotoxin is activated by an acid pH, forming anion channels of selective low-conductivity, which are voltage-dependent. This activity increases permeability, which favors anions over cations, facilitating CI- and HCO3- access and, although less efficiently, the entry of carboxylic acids, pyruvate and gluconate. The cytotoxin can interact with the lipidic double-layer, forming structures compatible with hexameral pores. It appears that the presence of both sub-units (P37 and P58) is essential to form the channels, with these two sub-units undergoing necessary changes in configuration to allow insertion of cytotoxin into the lipidic double-layer. The increase in the conductivity of ions in endosomal membranes activates the electrogenic V ATPase,88 favoring the flow of H+ and Cl- from the cytosol to the endosome lumen. This causes osmotic changes leading to an increase in water access and therefore, a swelling of the endosomal compartment.
VacA has several specific effects that may contribute to H. pylori persistence in the gastric mucosa. It forms pores in epithelial cell membranes, allowing the egress of anions and urea. This is important since urea hydrolysis, catalyzed by H. pylori urease, protects against gastric acidity. VacA also induces the loosening of epithelial tight junctions, potentially allowing nutrients to cross the mucosal barrier to H. pylori's gastric luminal niche. Recent in vitro work suggests that VacA may help H. pylori persistence by specific immune suppression, blocking phagosome maturation in macrophages, selectively inhibiting antigen presentation in T cells, blocking T cell proliferation, and downregulating Th1 effects by interacting with calcineurin to block signaling. In addition. VacA has direct cell-damaging effects in vitro, inducing cytoskeletal changes, apoptosis (in part by forming pores in mitochondrial membranes, allowing cytochrome C egress), suppression of epithelial cell proliferation and migration, as well as cell vacuolation.89 Whether these effects are important in vivo is unknown, but cell damage could aid nutrient delivery from the gastric mucosa.
All of these findings indicate that the vacuolating cytotoxin is an important virulence factor in the pathogenesis of gastric disease in humans. H. pylori strains expressing the protein associated with the cytotoxin, and those containing producers of vacuolating cytotoxin with high biological activity, have been isolated more frequently from patients with peptic ulcers than from patients with chronic gastritis. This has been shown in various studies where patients with high antibody levels against VacA and CagA proteins showed severe gastric pathologies,7,20,76 and have a greater risk for developing adenocarcinoma and gastric lymphoma.90
Future considerations
Since H. pylori was first isolated and its role in peptic ulcer disease was demonstrated about 20 years ago, knowledge about the bacterium has increased enormously. However, many questions remain unanswered and ongoing studies using biochemistry, and molecular and cell biology will certainly offer additional information that will help in understanding the pathogenesis of H. pylori infection. However, it is likely that only studies using human and appropriate animal models will be able to provide definitive answers to the following questions: Why does the underlying inflammatory response not lead to clearance of H. pylori infection?; Is it possible that H. pylori has adapted itself to colonize inflamed mucosal surfaces?; In that case, would inflammation be a prerequisite for initial or prolonged colonization, or both?; Why do some subjects develop gastric ulcers, duodenal ulcers or gastric cancer, while the majority of colonized subjects remain free of clinical disease?; What is the definitive transmission route for H. pylori?
References
1. Warren R. Discovery and Pathology of Helicobacter pylori. Xth International Workshop on Gastroduodenal Pathology and Helicobacter pylori; 1997 September 12-14; Lisboa, Portugal. [ Links ]
2. Helicobacter Foundation. Helicobacter pylori. 10th World Congress of Gastroenterology; 1994 October 2-7; Los Angeles, California. [ Links ]
3. Mobley HLT. Defining Helicobacter pylori as a Pathogen: Strain heterogeneity and virulence. Am J Med 1996;100:S2-S11. [ Links ]
4. Jerris RC. Helicobacter. En: Murray PR, Barron JE, Pfaller MA, Tenover FC, Yolken RH, ed. Manual of clinical microbiology. 6th Edition. Washington, DC: ASM Press; 1995:492-498. [ Links ]
5. Group 2. Aerobic/microaerophilic, motile, helical/vibrioid Gram-negative bacteria. Genus helicobacter. En: Holt JG, Krieg NR, Sneath PHA, Staley JT, Williams ST, ed. Bergey's manual of determinative Bacteriology. Ninth Edition. Baltimore (MD): Williams and Wilkins. 1994:42-43, 62. [ Links ]
6. Cave DR. Epidemiology and transmission of Helicobacter pylori infection. How is Helicobacter pylori transmitted? Gastroenterology 1997;113:S9-S14. [ Links ]
7. Everhart JE, Kruszon-Moran D, Pérez-Pérez GI, Tralka TS, McQuillan G. Seroprevalence and ethnic differences in Helicobacter pylori infection among adults in the United States. J Infect Dis 2000;181:1359-1363. [ Links ]
8. Torres J, Leal-Herrera Y, Pérez-Pérez G, Gómez A, Camorlinga-Ponce M, Cedillo-Rivera R et al. A community-based seroepidemiologic study of Helicobacter pylori infection in Mexico. J Infect Dis 1998;178: 1089-1094. [ Links ]
9. Dubois A, Berg DE, Incecik ET, Fiala N, Heman-Ackah LM, Pérez-Pérez GI et al. Transient and persistent infection of nonhuman primates with Helicobacter pylori: Implications for human disease. Infect Immun 1996;64:2885-2891. [ Links ]
10. Mitchell HM. Epidemiology of infection. En: Mobley HLT, Méndez GL, Hazell SL, ed. Helicobacter pylori: Physiology and genetics. Washington, DC: ASM Press; 2001:7-18. [ Links ]
11. Mazari-Hiriart M, López-Vidal Y, Calva JJ. Helicobacter pylori in water systems for human use in Mexico City. Water Sci Technol 2001;43: 93-98. [ Links ]
12. Mazari-Hiriart M, López-Vidal Y, Castillo-Rojas G, Ponce de León S, Cravioto A. Helicobacter pylori and other enteric bacteria in freshwater environments in Mexico City. Arch Med Res 2001;32:458-467. [ Links ]
13. Hegarty JP, Dowd MT, Baker KH. Occurrence of Helicobacter pylori in surface water in the United States. J Appl Microbiol 1999;87:697-701. [ Links ]
14. Klein PD, Gastrointestinal Physiology Working Group, Graham DY, Gaillour A, Opekun AR, Smith EO. Water source as risk for Helicobacter pylori infection in Peruvian children. Lancet 1991;337:1503-1506. [ Links ]
15. Hulten K, Han SW, Enroth H, Klein PD, Opekun AR, Gilman RH et al. Helicobacter pylori in drinking water in Peru. Gastroenterol 1996;110:1031-1035. [ Links ]
16. Goodman KJ, Correa P, Tengana-Aux HJ, Ramírez H, DeLany JP, Guerrero Pepinosa O et al. Helicobacter pylori infection in the Colombian Andes: A population-based study of transmission pathways. Am J Epidemiol 1996;144:290-299. [ Links ]
17. Hopkins RJ, Vial PA, Ferreccio C, Ovalle J, Prado P, Sotomayor V et al. Seroprevalence of Helicobacter pylori in Chile: Vegetables may serve as one route of transmission. J Infect Dis 1993;168:222-226. [ Links ]
18. Hultén K, Enroth H, Nyström T, Engstrand L. Presence of Helicobacter species DNA in Swedish water. J Appl Microbiol 1998;85:282-286. [ Links ]
19. Mazari-Hiriart M, López-Vidal Y, Ponce de León S, Calva-Mercado JJ, Rojo-Callejas F. Significance of water quality indicators: A case study in Mexico City. Proceedings of the International Conference: Water and Wastewater, Perspectives of Developing Countries. New Delhi, India: Indian Institute of Technology Delhi-International Water Association; 2002:407-416. [ Links ]
20. Cover T, Blaser JM. Helicobacter pylori: A bacteria cause of gastritis, peptic ulcer disease and gastric cancer. ASM News 1995;61:21-26. [ Links ]
21. Atherton JC, Tham KT, Peek RM, Cover TI, Blaser MJ. Density of Helicobacter pylori infection in vivo as assessed by quantitative culture and histology. J Infect Dis 1996;174:552-556. [ Links ]
22. Blaser MJ, Pérez-Pérez GI, Kleanthous H, Cover TL, Peek RM, Chyou PH et al. Infection with Helicobacter pylori strains possessing CagA is associated with an increased risk of developing adenocarcinoma of the stomach. Cancer Res 1995;55:2111-2115. [ Links ]
23. Parkin DM, Bray FI, Devesa SS. Cancer burden in the year 2000: The global picture. Eur J Cancer 2001;37:S4-S66. [ Links ]
24. Guarner J, Mohar A, Parsonnet J, Halperin D. The association of Helicobacter pylori with gastric cancer and pre-neoplastic gastric lesions in Chiapas, Mexico. Cancer 1993;71:297-301. [ Links ]
25. Uemura N, Okamoto S, Yamamoto S, Matsumura N, Yamaguchi S, Yamakido M et al. Helicobacter pylori infection and the development of gastric cancer. N Engl J Med 2001;345:784-789. [ Links ]
26. Dunn BE, Campbell GP, Pérez-Pérez GI, Blazer MJ. Purification and characterization of urease from Helicobacter pylori. J Biol Chem 1990;265:9464-9469. [ Links ]
27. Austin JW, Doig P, Stewart M, Trust TJ. Macromolecular structure and aggregation state of Helicobacter pylori urease. J Bacteriol 1991;173:5663-5667. [ Links ]
28. Labigne A, Cussac V, Courcoux P. Shuttle cloning and nucleotide sequences of Helicobacter pylori genes responsible for urease activity. J Bacteriol 1991;173:1920-1931. [ Links ]
29. Ferrero RL, Cussac V, Courcoux P, Labigne A. Construction of isogenic urease-negative mutants of Helicobacter pylori by allelic exchange. J Bacteriol 1992;174:4212-4217. [ Links ]
30. Tsuda M, Karita M, Morshed MG, Okita K, Nakazawa T. A urease-negative mutant of Helicobacter pylori constructed by allelic exchange mutagenesis lacks the ability to colonize the nude mouse stomach. Infect Immun 1994;62:3586-3589. [ Links ]
31. Eaton KA, Krakowka S. Effect of gastric pH on urease-dependent colonization of gnotobiotic piglets by Helicobacter pylori. Infect Immun 1994;62:3604-3607. [ Links ]
32. Berg D, Hoffman P, Appelmelk B, Kusters J. The Helicobacter pylori genome sequence: genetic factors for long life in the gastric mucosa. Trends Microbiol 1997;5:468-473. [ Links ]
33. Ricci V, Sommi P, Fiocca R, Romano M, Solcia E, Ventura U. Helicobacter pylori vacuolating toxin accumulates within the endosomal-vacuolar compartment of cultured gastric cells and potentates the vacuolating activity of ammonia. J Pathol 1997;183:453-459. [ Links ]
34. Eaton KA, Morgan DR, Krakowka S. Motility as a factor in the colonization of gnotobiotic piglets by Helicobacter pylori. J Med Microbiol 1992;37:123-127. [ Links ]
35. Geis G, Suerbaum S, Forsthoff B, Leying H, Opferkuch W. Ultrastructure and biochemical studies of the flagellar sheath of Helicobacter pylori. J Med Microbiol 1993;38:371-377. [ Links ]
36. Josenhans C, Labigne A, Suerbaum S. Comparative ultraestructural and functional studies of Helicobacter pylori and Helicobacter mustelae flagellin mutants: Both flagellin subunits, FlaA and FlaB, are necessary for full motility in Helicobacter species. J Bacteriol 1995;177:3010-3020. [ Links ]
37. Eaton KA, Suerbaum S, Josenhans C, Krakowka S. Colonization of gnotobiotic piglets by Helicobacter pylori deficient in two flagellin genes. Infect Immun 1996;64:2445-2448. [ Links ]
38. Dubreuil JD, Giudice GD, Rappuoli R. Helicobacter pylori interactions with host serum and extracellular matrix proteins: Potential role in the infectious process. Microbiol Mol Biol Rev 2002;66:617-629. [ Links ]
39. Guruge JL, Falk PG, Lorenz RG, Dans M, Wirth HP, Blaser MJ et al. Epithelial attachment alters the outcome of Helicobacter pylori infection. Proc Natl Acad Sci 1998;95:3925-3930. [ Links ]
40. Hennig EE, Mernaugh R, Edl J, Cao P, Cover TL. Heterogeneity among Helicobacter pylori Strains in expression of the outer membrane protein BabA. Infect Immun 2004;72:3429-3435. [ Links ]
41. Mahdavi J, Sondén B, Hurtig M, Olfat FO, Forsberg L, Roche N et al. Helicobacter pylori SabA adhesin in persistent infection and chronic inflammation. Science 2002;297:573-578. [ Links ]
42. Kronvall G, Jönson K. Receptins: A novel term for an expanding spectrum of natural and engineered microbial proteins with binding properties for mammalian protein. J Mol Recognit 1999;12:38-44. [ Links ]
43. Simoons-Smit IM, Appelmelk BJ, Verboom T, Negrini R, Penner JL, Aspinall GO et al. Typing of Helicobacter pylori with monoclonal antibodies against Lewis antigens in lipopolysaccharide. J Clin Microbiol 1996;34:2196-2200. [ Links ]
44. Abdulhamid M, Alkout M, Blackwell CC, Weir DM. Increased inflammatory responses of persons of blood group O to Helicobacter pylori. J Infect Dis 2000;181:1364-1369. [ Links ]
45. Aspinall GO, Monteiro MA. Lipopolysaccharides of Helicobacter pylori strains P466 and MO19: structures of the O antigen and core oligosaccharide strains. Biochemistry 1996;35:2498-2504. [ Links ]
46. Appelmelk BJ, Martino MC, Veenhof E, Monteiro MA, Maaskant JJ, Negrini R et al. Phase variation in H type I and Lewis a epitopes of Helicobacter pylori lipopolysaccharide. Infect Immun 2000;68:5928-5932. [ Links ]
47. Monteiro MA, Chan KH, Rasko DA, Taylor DE, Zheng PY, Appelmelk BJ et al. Simultaneous expression of type 1 and type 2 Lewis blood group antigens Helicobacter pylori lipopolysaccharides. J Biol Chem 1998;273:11533-11543. [ Links ]
48. Moran AP, Prendergast MM, Appelmelk BL. Molecular mimicry of host structure by bacterial lipopolysaccharides and contribution to disease. FEMS Immunol Med Microbiol 1996;16:105-115. [ Links ]
49. Takata T, El-Omar E, Camorlinga M, Thompson SA, Minohara Y, Ernst PB et al. Helicobacter pylori does not require Lewis X or Lewis Y expression to colonize C3H/HeJ mice. Infect Immun 2002;70: 3073-3079. [ Links ]
50. Negrini R, Lisato L, Zanella I, Cavazzini L, Gullini S, Villanacci V et al. Helicobacter pylori infection induced antibodies cross reacting with human gastric mucosa. Gastroenterology 1991;101:437-439. [ Links ]
51. Tummuru MKR, Cover TL, Blaser MJ. Cloning and expression of a high-molecular-mass major antigen of Helicobacter pylori: Evidence of linkage to cytotoxin production. Infect Immun 1993;61:1799-1809. [ Links ]
52. Xiang Z, Censini S, Bayeli PF, Telford JL, Figura N, Rappuoli R et al. Analysis of expression of CagA and VacA virulence factors in 43 strains of Helicobacter pylori reveals that clinical isolates can be divided into two mayor types and that CagA is not necessary for expression of the vacuolating toxin. Infect Immun 1995;63:94-98. [ Links ]
53. Tummuru MKR, Cover TL, Blaser MJ. Mutation of the cytotoxin-associated CagA gene does not affect the vacuolating cytotoxin activity of Helicobacter pylori. Infect Immun 1994;62:2609-2613. [ Links ]
54. Telford JL, Covacci A, Ghiara P, Montecucco C, Rappuoli R. Unravelling the pathogenic role of Helicobacter pylori in peptic ulcer: Potential new therapies and vaccines. TIBTECH 1993;12:420-425. [ Links ]
55. Evans DJ, Queiroz DMM, Mendes EN, Evans DG. Diversity in the variable region of Helicobacter pylori CagA gene involves more than simple repetition of a 102-nucleotide sequence. Biochem Biophys Res Commun 1998;245:780-784. [ Links ]
56. Yamaoka Y, Kodama T, Kashima K, Graham DY, Sepúlveda AR. Variants of the 3' region of the CagA gene in Helicobacter pylori isolates from patients with different H. pylori-associated diseases. J Clin Microbiol 1998;36:2258-2263. [ Links ]
57. Yamaoka Y, El_Zimaity HMT, Gutiérrez O, Figura N, Kim JK, Kodama T et al. Relationship between the CagA 3' repeat region of Helicobacter pylori, gastric histology, and susceptibility to low pH. Gastroenterology 1999;117:342-349. [ Links ]
58. Azuma T, Yamakama A, Yamazaki S, Fukuta K, Ohtani M, Ito Y et al. Correlation between variation of the 3' region of the CagA gene in Helicobacter pylori and disease outcome in Japan. J Infect Dis 2002;186:1621-1630. [ Links ]
59. Censini S, Lange C, Xiang Z, Crabtree JE, Ghiara P, Borodovsky M et al. Cag, a pathogenicity island of Helicobacter pylori, encodes type I-specific and disease-associated virulence factors. Proc Natl Acad Sci 1996;93:14648-14653. [ Links ]
60. Alm RA, Ling LS, Moir DT, King BL, Brown ED, Doig PC et al. Genomic-sequence comparison of two unrelated isolates of the human gastric pathogen Helicobacter pylori. Nature 1999;397:176-180. [ Links ]
61. Christie JP, Vogel JP. Bacterial type IV secretion: Conjugation systems adapted to deliver effector molecules to host cells. Trends Microbiol 2000;8:354-360. [ Links ]
62. Segal ED, Falkow S, Tompkins LS. Helicobacter pylori attachment to gastric cells induces cytoskeletal rearrangements and tyrosine phosphorylation of host cell proteins. Proc Natl Acad Sci 1996;93: 1259-1264. [ Links ]
63. Stein M, Rappuoli R, Covacci A. Tyrosine phosphorylation of the Helicobacter pylori CagA antigen after cag-driven host cell translocation. Proc Natl Acad Sci 2000;97:1263-1268. [ Links ]
64. Dundon WG, De Bernard M, Montecucco C. Virulence factors of Helicobacter pylori. Int J Med Microbiol 2001;290:647-658. [ Links ]
65. Covacci A, Rappuoli R. Tyrosine-phosphorylated bacterial proteins: Trojan horses for the host cell. J Exp Med 2000;191:587-592. [ Links ]
66. Amieva MR, Vogelmann R, Covacci A, Tompkins LS, Nelson WJ, Falkow S. Disruption of the epithelial apical-junctional complex by Helicobacter pylori CagA. Science 2003;300:1430-1434. [ Links ]
67. Backert S, Moese S, Selbach M, Brinkmann V, Meyer TF. Phosphorylation of tyrosine 972 of the Helicobacter pylori CagA protein is essential for induction of a scattering phenotype in gastric epithelial cells. Mol Microbiol 2001;42:631-644. [ Links ]
68. Stein M, Bagnoli F, Halenbeck R, Rappuoli R, Fantl WJ, Covacci A. C-Src/Lyn kinase activate Helicobacter pylori CagA through tyrosine phosphorylation of the EPIYA motifs. Mol Microbiol 2002;43:971-980. [ Links ]
69. Pan ZJ, Van der Hulst RW, Feller M, Xiao SD, Tytgat GN, Dankert J et al. Equally high prevalences of infection with CagA-positive Helicobacter pylori in Chinese patients with peptic ulcer disease and those with chronic gastritis-associated dyspepsia. J Clin Microbiol 1997;35: 1344-1347. [ Links ]
70. Van der Ende A, Pan ZJ, Bart A, Van der Hulst RW, Feller M, Xiao SD et al. CagA-positive Helicobacter pylori populations in China and the Netherlands are distinct. Infect Immun 1998;66:1822-1826. [ Links ]
71. Higashi H, Tsutsumi R, Fujita A, Yamazaki S, Asaka M, Azuma T et al. Biological activity of the Helicobacter pylori virulence factor CagA is determined by variation in the tyrosine phosphorylation sites. Proc Natl Acad Sci 2002;99:14428-14433. [ Links ]
72. Catrenich C, Chestnut M. Character and origin of vacuoles induced in mammalian cells by the cytotoxin of Helicobacter pylori. J Med Microbiol 1992;37:389-395. [ Links ]
73. Harris PR, Cover TL, Crowe DR, Orenstein JM, Graham MF, Blaser MJ et al. Helicobacter pylori cytotoxin induces vacuolation of primary human mucosal epithelial cell. Infect Immun 1996;64:4867-4871. [ Links ]
74. Telford J, Ghiara P, Dell'Orco M, Comanducci M, Burroni D, Bugnoli M. Gene structure of the Helicobacter pylori cytotoxin and evidence of its key role in gastric disease. J Exp Med 1994;179:1653-1658. [ Links ]
75. Tummuru M, Cover T, Blaser M. Cloning and expression of high molecular weight major antigen of Helicobacter pylori: Evidence of linkage to cytotoxin production. Infect Immun 1993;61:1799-1809. [ Links ]
76. Atherton J, Cao P, Peek R, Tummuru M, Blaser M, Cover T. Mosaicism in vacuolating cytotoxin alleles of Helicobacter pylori. J Biol Chem 1995;270:17771-17777. [ Links ]
77. Garner J, Cover T. Analysis of genetic diversity in cytotoxin-producing and non-cytotxin-producing Helicobacter pylori strains. J Infect Dis 1995;172:290-293. [ Links ]
78. Van Doorn LJ, Figueiredo C, Sanna R, Pena S, Midolo P, Ng EK et al. Expanding allelic diversity of Helicobacter pylori VacA. J Clin Microbiol 1998;36:2597-2603. [ Links ]
79. Strobel S, Bereswill S, Balig P, Allgaier P, Sonntag HG, Kist M. Identification and analysis of a new VacA genotype variant of Helicobacter pylori in different patient groups in Germany. J Clin Microbiol 1998;36:1285-1289. [ Links ]
80. Huseyin S, Salih BA, Yamaoka Y, Sander E. Analysis of Helicobacter pylori genotypes and correlation with clinical outcome in Turkey. J Clin Microbiol 2004;42:1648-1651. [ Links ]
81. Morales-Espinosa R, Castillo-Rojas G, Ponce de León S, Cravioto A, Atherton JC, López-Vidal Y. Colonization of Mexican patients by multiple Helicobacter pylori strains with different VacA and CagA genotypes. J Clin Microbiol 1999;37:3001-3004. [ Links ]
82. Moll G, Papini E, Colonna R, Burroni D, Telford J, Rappuoli R et al. Lipid interaction of the 37-kDa and 58-kDa fragments of the Helicobacter pylori cytotoxin. Eur J Biochem 1995;234:947-952. [ Links ]
83. Lanzavecchia S, Bellon PL. Three-dimensional reconstruction of metal replicas of the Helicobacter pylori vacuolating cytotoxin. J Struct Biol 1998;121:9-18. [ Links ]
84. Seto K, Hayashi-Kuwabara Y, Yoneta T, Suda H, Tamaki H. Vacuolation induced by cytotoxin from Helicobacter pylori is mediated by the EGF receptor in HeLa cell. FEBS Lett 1998;431:347-350. [ Links ]
85. Yahiro K, Niidome T, Hatakeyama T, Aoyagi H, Kurazono H, Padilla PI et al. Helicobacter pylori vacuolating cytotoxin binds to the 140-kDa protein in human gastric cancer cell lines AZ-521 and AGS. Biochem Biophys Res Commun 1997;238:629-632. [ Links ]
86. Papini E, De Bernard M, Milia E, Bugnoli M, Zerial M, Rappuoli R et al. Cellular vacuoles induced by Helicobacter pylori originate from late endosomal compartments. Proc Natl Acad Sci 1994;91:9720-9724. [ Links ]
87. Papini E, Gottardi E, Satin B, De Bernard M, Massari P, Telford J et al. The vacuolar ATPase proton pump is present on intracellular vacuoles induced by Helicobacter pylori. J Med Microbiol 1996;45:84-89. [ Links ]
88. Tombola F, Carlesso C, Szabo I, De Bernard M, Reyrat JM, Telford JL et al. Helicobacter pylori vacuolating toxin forms anion-selective channels in planar lipid bilayers: Possible implications for the mechanism of cellular vacuolation. Biophys J 1999;76:1401-1409. [ Links ]
89. Blaser MJ, Atherton JC. Helicobacter pylori persistence: Biology and disease. J Clin Invest 2004;113:321-333. [ Links ]
90. Weel JF, Van der Hulst RW, Gerrits Y, Roorda P, Feller M, Dankert J et al. The interrelationship between cytotoxin-associated gene A, vacuolating cytotoxin, and Helicobacter pylori-related diseases. J Infect Dis 1996;173:1171-1175. [ Links ]
Address reprint requests to
Dra. Yolanda López Vidal
Programa de Inmunología Molecular Microbiana, Departamento de Microbiología y Parasitología
Facultad de Medicina, Universidad Nacional Autónoma de México
Edificio de investigación, 4to piso
04510 México, DF, México
E-mail: lvidal@servidor.unam.mx
Received on: February 25, 2004
Accepted on: September 15, 2004









